PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.8G104000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 271aa    MW: 29519.9 Da    PI: 10.5541
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.8G104000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.6e-172065147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        rg W + Ede+l ++v ++G+ +W++Ia+++  gR++k+c++rw++ 
  Sevir.8G104000.1.p 20 RGHWRPGEDEKLRQLVDKYGPQNWNSIAEKLE-GRSGKSCRLRWFNQ 65
                        899*****************************.***********996 PP

2Myb_DNA-binding60.43.9e-1973116247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          ++T+eE+e+l++a++ +G++ W++Iar ++ gRt++ +k++w+ +
  Sevir.8G104000.1.p  73 RPFTEEEEERLLNAHRVHGNK-WALIARLFP-GRTDNAVKNHWHVV 116
                         69*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.0871566IPR017930Myb domain
SuperFamilySSF466894.87E-3018113IPR009057Homeodomain-like
SMARTSM007171.4E-131968IPR001005SANT/Myb domain
PfamPF002492.5E-162065IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-262173IPR009057Homeodomain-like
CDDcd001671.08E-132364No hitNo description
PROSITE profilePS5129427.7867121IPR017930Myb domain
SMARTSM007173.5E-1671119IPR001005SANT/Myb domain
PfamPF002494.1E-1672115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2274119IPR009057Homeodomain-like
CDDcd001671.39E-1374117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MPSSSTTNTS DGTKSSSCPR GHWRPGEDEK LRQLVDKYGP QNWNSIAEKL EGRSGKSCRL  60
RWFNQLDPRI NKRPFTEEEE ERLLNAHRVH GNKWALIARL FPGRTDNAVK NHWHVVMARR  120
SRERSRLLAR AATSSSPSSA YPFGAGTPAA SSSLCFGFSK LGGGGGMFSS PPAARPTSLF  180
KSFGTATGSK SFLGASFEAA RYSYSGRQAA PPVSITFSSP REALTMDIGR HGHHEHVHGQ  240
KDYHASEGGD EALKRKDVPF IDFLGVGVSS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-33201207107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8586821e-146HQ858682.1 Zea mays clone UT1138 MYB transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004979129.10.0PREDICTED: trichome differentiation protein GL1-like
TrEMBLK3ZJJ80.0K3ZJJ8_SETIT; Uncharacterized protein
STRINGSi026751m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.13e-61myb domain protein 52